Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM219A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C9orf25 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM219A Polyclonal specifically detects FAM219A in Human samples. It is validated for Western Blot.Specifications
C9orf25 | |
Polyclonal | |
Rabbit | |
bA573M23.5, C9orf25, chromosome 9 open reading frame 25, family with sequence similarity 219, member A, hypothetical protein LOC203259 | |
FAM219A | |
IgG | |
18 kDa |
Western Blot | |
Unconjugated | |
RUO | |
203259 | |
Synthetic peptides corresponding to C9ORF25 The peptide sequence was selected from the middle region of C9ORF25. Peptide sequence SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title