Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM36A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM36A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM36A Polyclonal specifically detects FAM36A in Human samples. It is validated for Western Blot.Specifications
FAM36A | |
Polyclonal | |
Rabbit | |
NP_932342 | |
116228 | |
Synthetic peptide directed towards the C terminal of human FAM36AThe immunogen for this antibody is FAM36A. Peptide sequence LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family with sequence similarity 36, member A, FLJ43269 | |
COX20 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title