Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM53C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM53C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM53C Polyclonal specifically detects FAM53C in Human samples. It is validated for Western Blot.Specifications
FAM53C | |
Polyclonal | |
Rabbit | |
Q9NYF3 | |
51307 | |
Synthetic peptides corresponding to FAM53C(family with sequence similarity 53, member C) Antibody(against the N terminal of FAM53C. Peptide sequence SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C5orf6, chromosome 5 open reading frame 6, family with sequence similarity 53, member C, hypothetical protein LOC51307, putative nuclear protein | |
FAM53C | |
IgG | |
43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title