Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM58A Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310183100UL
Description
FAM58A Polyclonal specifically detects FAM58A in Mouse samples. It is validated for Western Blot.Specifications
FAM58A | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
cyclin M, cyclin-M, cyclin-related protein FAM58A, family with sequence similarity 58, member A, MGC29729, STAR | |
The immunogen is a synthetic peptide directed towards the middle region of mouse FAM58A (NP_932106.1). Peptide sequence LAGKVEEQHLRTRDIINVSHRYFNPGSEPLELDSRFWELRDSIVQCELLM | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
92002 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction