Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM71A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM71A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM71A Polyclonal specifically detects FAM71A in Human samples. It is validated for Western Blot.Specifications
FAM71A | |
Polyclonal | |
Rabbit | |
Human | |
family with sequence similarity 71, member A, FLJ32796, hypothetical protein LOC149647, RP11-338C15.4 | |
FAM71A | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8IYT1 | |
149647 | |
Synthetic peptides corresponding to FAM71A(family with sequence similarity 71, member A) The peptide sequence was selected from the C terminal of FAM71A. Peptide sequence DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title