Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM78A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM78A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM78A Polyclonal specifically detects FAM78A in Human samples. It is validated for Western Blot.Specifications
FAM78A | |
Polyclonal | |
Rabbit | |
Q5JUQ0 | |
286336 | |
Synthetic peptides corresponding to FAM78A(family with sequence similarity 78, member A) The peptide sequence was selected from the N terminal of FAM78A. Peptide sequence MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C9orf59, chromosome 9 open reading frame 59, family with sequence similarity 78, member A, FLJ00024, hypothetical protein LOC286336 | |
FAM78A | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title