Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM78A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FAM78A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156951
|
Novus Biologicals
NBP156951 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FAM78A Polyclonal specifically detects FAM78A in Human samples. It is validated for Western Blot.Specifications
| FAM78A | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C9orf59, chromosome 9 open reading frame 59, family with sequence similarity 78, member A, FLJ00024, hypothetical protein LOC286336 | |
| FAM78A | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5JUQ0 | |
| 286336 | |
| Synthetic peptides corresponding to FAM78A(family with sequence similarity 78, member A) The peptide sequence was selected from the N terminal of FAM78A. Peptide sequence MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title