FAM80A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157618

Catalog No. NBP157618

Description

FAM80A Polyclonal specifically detects FAM80A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM80A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: RIMKLA
• Immunogen: Synthetic peptides corresponding to FAM80A(family with sequence similarity 80, member A) The peptide sequence was selected from the middle region of FAM80A. Peptide sequence EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Canine: 100%; Mouse: 100%; Human: 100%Western clawed frog: 92%; Zebrafish: 85%; Green puffer: 85%; Bovine: 78%;.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 6.3.2.n6, FAM80A, family with sequence similarity 80, member A, MGC47816, NAAG synthetase A, NAAGS, ribosomal modification protein rimK-like family member A, Ribosomal protein S6 modification-like protein A, RP11-157D18.1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 284716
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.