Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM80A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	FAM80A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP157618 View Documents View Product Certificates	Novus Biologicals NBP157618	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FAM80A Polyclonal specifically detects FAM80A in Human samples. It is validated for Western Blot.

Specifications

Antigen	FAM80A
Classification	Polyclonal
Host Species	Rabbit
Gene Alias	EC 6.3.2.n6, FAM80A, family with sequence similarity 80, member A, MGC47816, NAAG synthetase A, NAAGS, ribosomal modification protein rimK-like family member A, Ribosomal protein S6 modification-like protein A, RP11-157D18.1
Gene Symbols	RIMKLA
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	284716
Immunogen	Synthetic peptides corresponding to FAM80A(family with sequence similarity 80, member A) The peptide sequence was selected from the middle region of FAM80A. Peptide sequence EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FAM80A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents