Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM83A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | FAM83A |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124323
|
Novus Biologicals
NBP309711100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
FAM83A Polyclonal specifically detects FAM83A in Human samples. It is validated for Western Blot.Specifications
FAM83A | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
BJ-TSA-9, family with sequence similarity 83, member A, hypothetical protein LOC84985, MGC14128, TSGP, Tumor antigen BJ-TSA-9, Tumor-specific gene expressed in prostate protein | |
The immunogen for Anti-FAM83A antibody is: synthetic peptide directed towards the C-terminal region of Human FA83A. Peptide sequence MGLKSPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGT | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
84985 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title