Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM83B Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen FAM83B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179546
SDP
View Documents
Novus Biologicals
NBP179546
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

FAM83B Polyclonal specifically detects FAM83B in Human samples. It is validated for Western Blot.
Specifications

Specifications

FAM83B
Polyclonal
Rabbit
Human
C6orf143, family with sequence similarity 83, member B, MGC126677, MGC138480
FAM83B
IgG
Western Blot
Unconjugated
RUO
NP_001010872
222584
Synthetic peptide directed towards the C terminal of human FAM83BThe immunogen for this antibody is FAM83B. Peptide sequence PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF.
Primary
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.