Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM83B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | FAM83B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM83B Polyclonal specifically detects FAM83B in Human samples. It is validated for Western Blot.Specifications
| FAM83B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C6orf143, family with sequence similarity 83, member B, MGC126677, MGC138480 | |
| FAM83B | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001010872 | |
| 222584 | |
| Synthetic peptide directed towards the C terminal of human FAM83BThe immunogen for this antibody is FAM83B. Peptide sequence PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title