Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FANCD2OS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FANCD2OS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FANCD2OS Polyclonal specifically detects FANCD2OS in Human samples. It is validated for Western Blot.Specifications
FANCD2OS | |
Polyclonal | |
Rabbit | |
C3orf24, chromosome 3 open reading frame 24, fancd2 opposite strand, hypothetical protein LOC115795, RGD1565997 | |
FANCD2OS | |
IgG | |
20 kDa |
Western Blot | |
Unconjugated | |
RUO | |
115795 | |
Synthetic peptides corresponding to C3ORF24 The peptide sequence was selected from the middle region of C3ORF24. Peptide sequence KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title