FANCL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406865	Novus Biologicals NBP18475825UL	25ul
NBP184758	Novus Biologicals NBP184758	0.1 mL

Description

FANCL Polyclonal specifically detects FANCL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FANCL
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: E3 ubiquitin-protein ligase FANCL, EC 6.3.2.-, FAAP43PHF9FLJ10335, Fanconi anemia group L protein, Fanconi anemia, complementation group L, Fanconi anemia-associated polypeptide of 43 kDa, PHD finger protein 9, Pog
• Gene Symbols: FANCL
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, DNA Repair, Genes Sensitive to DNA Damaging Agents
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 55120
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFC
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only