Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FANK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FANK1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FANK1 Polyclonal specifically detects FANK1 in Mouse samples. It is validated for Western Blot.Specifications
FANK1 | |
Polyclonal | |
Rabbit | |
Q9DAM9 | |
92565 | |
Synthetic peptides corresponding to Fank1 (fibronectin type 3 and ankyrin repeat domains 1) The peptide sequence was selected from the middle region of Fank1. Peptide sequence LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
1700007B22Rik, fibronectin type 3 and ankyrin repeat domains 1, fibronectin type 3 and ankyrin repeat domains protein 1, fibronectin type III and ankyrin repeat domains 1 | |
FANK1 | |
IgG | |
38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title