Fas Ligand/TNFSF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24916025UL

Catalog No. NB395825

Description

Fas Ligand/TNFSF6 Polyclonal antibody specifically detects Fas Ligand/TNFSF6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Fas Ligand/TNFSF6
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: apoptosis (APO-1) antigen ligand 1, Apoptosis antigen ligand, APT1LG1CD95L, APTL, CD178, CD178 antigen, CD95-L, Fas antigen ligand, Fas ligand, Fas ligand (TNF superfamily, member 6), FASLCD95 ligand, TNFSF6FasL, tumor necrosis factor (ligand) superfamily, member 6, tumor necrosis factor ligand superfamily member 6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV
• Quantity: 25 μL
• Research Discipline: Adaptive Immunity, Apoptosis, Cancer, Diabetes Research, Immunology, Inhibitors Activators and Regulators
• Gene ID (Entrez): 356
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified