Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Fast skeletal myosin light chain 2 Antibody, Novus Biologicals™

Fast skeletal myosin light chain 2 Antibody, Novus Biologicals™
SDP

Catalog No. p-200058626 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393068 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB393068 Supplier Novus Biologicals Supplier No. NBP26262525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Fast skeletal myosin light chain 2 Polyclonal antibody specifically detects Fast skeletal myosin light chain 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Fast skeletal myosin light chain 2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias DKFZp779C0757, Fast skeletal myosin light chain 2, HUMMLC2B, MGC13450, MLC2B, MRLC2, MYL11, myosin light chain 2, myosin light chain, phosphorylatable, fast skeletal muscle, myosin regulatory light chain 2, skeletal muscle isoform, myosin, light chain 11, regulatory
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KGTIKKKFLEELLTTQCDRFSQEEIKNMWAAF
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29895
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.