Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fast skeletal myosin light chain 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | Fast skeletal myosin light chain 2 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Fast skeletal myosin light chain 2 Polyclonal antibody specifically detects Fast skeletal myosin light chain 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Fast skeletal myosin light chain 2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DKFZp779C0757, Fast skeletal myosin light chain 2, HUMMLC2B, MGC13450, MLC2B, MRLC2, MYL11, myosin light chain 2, myosin light chain, phosphorylatable, fast skeletal muscle, myosin regulatory light chain 2, skeletal muscle isoform, myosin, light chain 11, regulatory | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KGTIKKKFLEELLTTQCDRFSQEEIKNMWAAF | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 29895 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title