Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FASTKD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155360
Description
FASTKD2 Polyclonal specifically detects FASTKD2 in Human samples. It is validated for Western Blot.Specifications
FASTKD2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q9NYY8 | |
FASTKD2 | |
Synthetic peptides corresponding to FASTKD2(FAST kinase domains 2) The peptide sequence was selected from the middle region of FASTKD2. Peptide sequence DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR. | |
Affinity Purified | |
RUO | |
22868 | |
Human, Equine | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FAST kinase domains 2, KIAA0971FAST kinase domain-containing protein 2 | |
Rabbit | |
81 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title