Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAT10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | FAT10 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15833720
![]() |
Novus Biologicals
NBP15833720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP158337
![]() |
Novus Biologicals
NBP158337 |
100 μL |
Each for $487.50
|
|
|||||
Description
FAT10 Polyclonal specifically detects FAT10 in Human samples. It is validated for Western Blot.Specifications
FAT10 | |
Polyclonal | |
Rabbit | |
O15205 | |
10537 | |
Synthetic peptides corresponding to UBD(ubiquitin D) The peptide sequence was selected from the N terminal of UBD. Peptide sequence RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10 | |
UBD | |
IgG | |
18 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title