Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAT10 Rabbit anti-Human, Mouse, Rat, Clone: 10A6T5, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP31673120UL
This item is not returnable.
View return policy
Description
FAT10 Monoclonal antibody specifically detects FAT10 in Human, Mouse, Rat samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
FAT10 | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot, Immunofluorescence | |
10A6T5 | |
Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10 | |
A synthetic peptide corresponding to a sequence within amino acids 70-150 of human FAT10 (O15205). KEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI | |
20 μg | |
Cell Biology, Immunology | |
10537 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction