Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAT10 Rabbit anti-Human, Mouse, Rat, Clone: 10A6T5, Novus Biologicals™
SDP

Catalog No. p-7248222 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168554 20 μg
NB168553 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB168554 Supplier Novus Biologicals Supplier No. NBP31673120UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Monoclonal Antibody

FAT10 Monoclonal antibody specifically detects FAT10 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen FAT10
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 10A6T5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human FAT10 (O15205). KEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cell Biology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 10537
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.