FBXO11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155066

Catalog No. NBP155066

Description

FBXO11 Polyclonal specifically detects FBXO11 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

• Antigen: FBXO11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: F-box only protein 11, F-box protein 11, FBX11MGC44383, FLJ12673, PRMT9VIT1protein arginine N-methyltransferase 9, ubiquitin protein ligase E3 component n-recognin 6, UBR6, VIT-1, Vitiligo-associated protein 1, vitiligo-associated protein VIT-1
• Host Species: Rabbit
• Molecular Weight of Antigen: 94 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, ChIP Assay
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP)
• Gene Accession No.: Q86XK2
• Gene Symbols: FBXO11
• Immunogen: Synthetic peptides corresponding to FBXO11(F-box protein 11) The peptide sequence was selected from the middle region of FBXO11 (NP_079409). Peptide sequence HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80204
• Target Species: Human, Mouse, Rat, Amphibian, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only