Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXO22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $501.50

Specifications

Antigen	FBXO22
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15542520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15542520UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155425 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155425	100 μL	Each for $501.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FBXO22 Polyclonal specifically detects FBXO22 in Human samples. It is validated for Western Blot.

Specifications

Antigen	FBXO22
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q8NEZ5
Gene ID (Entrez)	26263
Immunogen	Synthetic peptides corresponding to FBXO22(F-box protein 22) The peptide sequence was selected from the middle region of FBXO22. Peptide sequence CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	F-box only protein 22, F-box protein 22, F-box protein FBX22p44, FBX22FLJ13986, FIST domain containing 1, FISTC1, MGC31799
Gene Symbols	FBXO22
Isotype	IgG
Molecular Weight of Antigen	30 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FBXO22 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents