Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO22 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | FBXO22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15542520
|
Novus Biologicals
NBP15542520UL |
20 μL |
Each for $152.22
|
|
NBP155425
|
Novus Biologicals
NBP155425 |
100 μL |
Each for $436.00
|
|
Description
FBXO22 Polyclonal specifically detects FBXO22 in Human samples. It is validated for Western Blot.Specifications
| FBXO22 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| F-box only protein 22, F-box protein 22, F-box protein FBX22p44, FBX22FLJ13986, FIST domain containing 1, FISTC1, MGC31799 | |
| FBXO22 | |
| IgG | |
| Affinity Purified | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NEZ5 | |
| 26263 | |
| Synthetic peptides corresponding to FBXO22(F-box protein 22) The peptide sequence was selected from the middle region of FBXO22. Peptide sequence CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title