Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO27 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FBXO27 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FBXO27 Polyclonal specifically detects FBXO27 in Human samples. It is validated for Western Blot.Specifications
FBXO27 | |
Polyclonal | |
Rabbit | |
Q8NI29 | |
126433 | |
Synthetic peptides corresponding to FBXO27(F-box protein 27) The peptide sequence was selected from the middle region of FBXO27. Peptide sequence LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Fbg5, FBG5FBX27, F-box only protein 27, F-box protein 27, F-box protein FBG5, F-box/G-domain protein 5, Fbx27 | |
FBXO27 | |
IgG | |
31 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title