Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FBXO34 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FBXO34 Polyclonal specifically detects FBXO34 in Human samples. It is validated for Western Blot.Specifications
FBXO34 | |
Polyclonal | |
Rabbit | |
Q9NWN3 | |
55030 | |
Synthetic peptides corresponding to FBXO34(F-box protein 34) The peptide sequence was selected from the middle region of FBXO34. Peptide sequence ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp547C162, F-box only protein 34, F-box protein 34, FBX34, FLJ20725, MGC126434, MGC126435, protein CGI-301 | |
FBXO34 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title