FBXO34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168997

Catalog No. NBP168997

Description

FBXO34 Polyclonal specifically detects FBXO34 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: FBXO34
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: FBXO34
• Immunogen: Synthetic peptides corresponding to Fbxo34 (F-box protein 34) The peptide sequence was selected from the N terminal of Fbxo34. Peptide sequence RDTLRTPMSHGKANGDVKARASYMKPTVLPSASLVKASSRKPFGILSPNV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55030
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: DKFZp547C162, F-box only protein 34, F-box protein 34, FBX34, FLJ20725, MGC126434, MGC126435, protein CGI-301
• Host Species: Rabbit
• Molecular Weight of Antigen: 82 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: ; Pig: 86%; Rabbit: 86%; Guinea pig: 86%.
• Target Species: Rat, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG