Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO34 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FBXO34 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156540
|
Novus Biologicals
NBP156540 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FBXO34 Polyclonal specifically detects FBXO34 in Human samples. It is validated for Western Blot.Specifications
| FBXO34 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp547C162, F-box only protein 34, F-box protein 34, FBX34, FLJ20725, MGC126434, MGC126435, protein CGI-301 | |
| FBXO34 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NWN3 | |
| 55030 | |
| Synthetic peptides corresponding to FBXO34(F-box protein 34) The peptide sequence was selected from the middle region of FBXO34. Peptide sequence ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title