FBXW2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23908925UL

Catalog No. NB436012

Description

FBXW2 Polyclonal specifically detects FBXW2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FBXW2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q9UKT8
• Gene Symbols: FBXW2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: F-box and WD repeat domain containing 2, F-box and WD-40 domain protein 2, F-box and WD-40 domain-containing protein 2, F-box/WD repeat-containing protein 2, FBW2Fwd2, FWD2, Md6, MGC117371, Protein MD6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26190
• Target Species: Human
• Isotype: IgG