Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXW2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	FBXW2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155043 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155043	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

FBXW2 Polyclonal specifically detects FBXW2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	FBXW2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9UKT8
Gene ID (Entrez)	26190
Immunogen	Synthetic peptides corresponding to FBXW2(F-box and WD repeat domain containing 2) The peptide sequence was selected from the middle region of FBXW2. Peptide sequence SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	F-box and WD repeat domain containing 2, F-box and WD-40 domain protein 2, F-box and WD-40 domain-containing protein 2, F-box/WD repeat-containing protein 2, FBW2Fwd2, FWD2, Md6, MGC117371, Protein MD6
Gene Symbols	FBXW2
Isotype	IgG
Molecular Weight of Antigen	51 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FBXW2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents