Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXW8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156338
Description
FBXW8 Polyclonal specifically detects FBXW8 in Human samples. It is validated for Western Blot.Specifications
FBXW8 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
F-box and WD repeat domain containing 8, F-box only protein 29F-box/WD repeat-containing protein 8, FBW8F-box and WD-40 domain-containing protein 8, FBX29MGC33534, FBXO29, FBXW6FBW6F-box and WD-40 domain protein 8 | |
Rabbit | |
Affinity purified | |
RUO | |
26259 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8N3Y1 | |
FBXW8 | |
Synthetic peptides corresponding to FBXW8(F-box and WD repeat domain containing 8) The peptide sequence was selected from the middle region of FBXW8. Peptide sequence MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Canine: 91%; Equine: 91%; Mouse: 91%; Rat: 91%; Bovine: 83%; Guinea pig: 83%; Pig: 83%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction