FBXW8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156338

Catalog No. NBP156338

Description

FBXW8 Polyclonal specifically detects FBXW8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXW8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: F-box and WD repeat domain containing 8, F-box only protein 29F-box/WD repeat-containing protein 8, FBW8F-box and WD-40 domain-containing protein 8, FBX29MGC33534, FBXO29, FBXW6FBW6F-box and WD-40 domain protein 8
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26259
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N3Y1
• Gene Symbols: FBXW8
• Immunogen: Synthetic peptides corresponding to FBXW8(F-box and WD repeat domain containing 8) The peptide sequence was selected from the middle region of FBXW8. Peptide sequence MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Canine: 91%; Equine: 91%; Mouse: 91%; Rat: 91%; Bovine: 83%; Guinea pig: 83%; Pig: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only