Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXW9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FBXW9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FBXW9 Polyclonal specifically detects FBXW9 in Human samples. It is validated for Western Blot.Specifications
FBXW9 | |
Polyclonal | |
Rabbit | |
NP_115677 | |
84261 | |
Synthetic peptide directed towards the C terminal of human FBXW9The immunogen for this antibody is FBXW9. Peptide sequence PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
F-box and WD repeat domain containing 9, F-box and WD-40 domain protein 9, F-box and WD-40 domain-containing protein 9, F-box and WD-40 repeat containing protein 9, specificity factor for SCF ubiquitin ligase | |
FBXW9 | |
IgG | |
51 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title