Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FCGR2C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309539100UL
Description
FCGR2C Polyclonal specifically detects FCGR2C in Human samples. It is validated for Western Blot.Specifications
FCGR2C | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
low affinity immunoglobulin gamma Fc region receptor II-c, CD32, CD32C, CDW32, Fc fragment of IgG, low affinity IIc, receptor for (CD32) (gene/pseudogene), FCG2, FCRIIC, IGFR2 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FCGR2C (NP_963857). Peptide sequence GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
9103 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction