Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FCRL6/FcRH6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | FCRL6/FcRH6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FCRL6/FcRH6 Polyclonal specifically detects FCRL6/FcRH6 in Human samples. It is validated for Western Blot.Specifications
| FCRL6/FcRH6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Fc receptor-like 6, FLJ16056 | |
| FCRL6 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001004310 | |
| 343413 | |
| Synthetic peptide directed towards the middle region of human FCRL6. Peptide sequence LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title