FE65 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24868225UL

Catalog No. NB396039

Description

FE65 Polyclonal antibody specifically detects FE65 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: FE65
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: adaptor protein FE65a2, amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65), amyloid beta A4 precursor protein-binding, family B, member 1, Fe65, FE65amyloid beta A4 precursor protein-binding family B member 1, MGC:9072, Protein Fe65, RIR, stat-like protein
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGI
• Quantity: 25 μL
• Research Discipline: Alzheimers Research, Cell Cycle and Replication, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 322
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified