Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ferredoxin Reductase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Ferredoxin Reductase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Ferredoxin Reductase Polyclonal specifically detects Ferredoxin Reductase in Human samples. It is validated for Western Blot.Specifications
Ferredoxin Reductase | |
Polyclonal | |
Rabbit | |
P22570 | |
2232 | |
Synthetic peptides corresponding to FDXR(ferredoxin reductase) The peptide sequence was selected from the middle region of FDXR. Peptide sequence LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Adrenodoxin reductase, ADXREC 1.18.1.2, ferredoxin reductaseAR, Ferredoxin--NADP(+) reductase, NADPH:adrenodoxin oxidoreductase, mitochondrial | |
FDXR | |
IgG | |
54 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title