Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578744

Invitrogen™ Fetuin A Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578744
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578744 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578744 Supplier Invitrogen™ Supplier No. PA578744
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human HCCT tissue, human HCCP tissue, rat plasma. IHC: Human Liver Cancer tissue. Flow: HEPG2 cell.

Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fetuin A
Applications ELISA, Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene AHSG
Gene Accession No. P02765, P24090
Gene Alias 59 kDa bone sialic acid-containing protein; A2HS; Aa2-066; AHS; AHSG; alpha 2 HS-glycoprotein alpha 2 (fetuin); alpha 2-HS glycoprotein; alpha-2-HS-glycoprotein; Alpha-2-HS-glycoprotein chain A; Alpha-2-HS-glycoprotein chain B; Alpha-2-Z-globulin; asialofetuin; Ba-alpha-2-glycoprotein; BSP; Countertrypin; FETUA; fetuin; fetuin A; FetuinA; fetuin-A; Glycoprotein PP63; HSGA; phosphorylated N-glycoprotein pp63; pp63; PRO2743
Gene Symbols AHSG
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Fetuin A (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 197, 25373
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.