Invitrogen™ Fetuin A Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578744

Catalog No. PIPA578744

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human HCCT tissue, human HCCP tissue, rat plasma. IHC: Human Liver Cancer tissue. Flow: HEPG2 cell.

Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.

Specifications

• Antigen: Fetuin A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: AHSG
• Gene Alias: 59 kDa bone sialic acid-containing protein; A2HS; Aa2-066; AHS; AHSG; alpha 2 HS-glycoprotein alpha 2 (fetuin); alpha 2-HS glycoprotein; alpha-2-HS-glycoprotein; Alpha-2-HS-glycoprotein chain A; Alpha-2-HS-glycoprotein chain B; Alpha-2-Z-globulin; asialofetuin; Ba-alpha-2-glycoprotein; BSP; Countertrypin; FETUA; fetuin; fetuin A; FetuinA; fetuin-A; Glycoprotein PP63; HSGA; phosphorylated N-glycoprotein pp63; pp63; PRO2743
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 197, 25373
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: ELISA, Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5 mg BSA and 0.05 mg sodium azide
• Gene Accession No.: P02765, P24090
• Gene Symbols: AHSG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Fetuin A (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG