FGF-11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255935

Catalog No. NBP255935

Description

FGF-11 Polyclonal specifically detects FGF-11 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FGF-11
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FGF-11, FHF-3, FHF3Fibroblast growth factor homologous factor 3, fibroblast growth factor 11, FLJ16061, MGC102953, MGC45269
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FGF11
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
• Quantity: 100 μL
• Research Discipline: Angiogenesis, Neuroscience
• Gene ID (Entrez): 2256
• Target Species: Human
• Isotype: IgG

For Research Use Only