Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGF-11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FGF-11 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FGF-11 Polyclonal specifically detects FGF-11 in Human samples. It is validated for Western Blot.Specifications
FGF-11 | |
Polyclonal | |
Rabbit | |
Angiogenesis, Neuroscience | |
FGF-11, FHF-3, FHF3Fibroblast growth factor homologous factor 3, fibroblast growth factor 11, FLJ16061, MGC102953, MGC45269 | |
FGF11 | |
IgG | |
25 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q92914 | |
2256 | |
Synthetic peptides corresponding to FGF11 (fibroblast growth factor 11) The peptide sequence was selected from the N terminal of FGF11. Peptide sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title