Invitrogen™ FGF9 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579260

Catalog No. PIPA579260

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human COLO-320 whole cell, rat brain tissue, mouse brain tissue.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis.

Specifications

• Antigen: FGF9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FGF9
• Gene Alias: Eks; elbow knee synostosis; FGF; Fgf9; FGF-9; Fibroblast growth factor; Fibroblast growth factor 9; fibroblast growth factor 9 (glia-activating factor); GAF; glia activating factor; glia-activating factor; HBFG-9; HBGF-9; Heparin-binding growth factor 9; M-FGF-9; SYNS3
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14180, 2254, 25444
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P31371, P36364, P54130
• Gene Symbols: FGF9
• Immunogen: A synthetic peptide corresponding to a sequence of human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG