Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGFBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FGFBP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179846
|
Novus Biologicals
NBP179846 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FGFBP2 Polyclonal specifically detects FGFBP2 in Human samples. It is validated for Western Blot.Specifications
| FGFBP2 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 37 kDa killer-specific secretory protein, FGF-binding protein 2, FGF-BP2, FGFBP-2, fibroblast growth factor binding protein 2, fibroblast growth factor-binding protein 2, HBp17-RP, HBP17RP, killer-specific secretory protein of 37 kDa, Ksp37, KSP37HBp17-related protein | |
| FGFBP2 | |
| IgG | |
| Affinity Purified | |
| 24 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| NP_114156 | |
| 83888 | |
| Synthetic peptide directed towards the C terminal of human FGFBP2The immunogen for this antibody is FGFBP2. Peptide sequence LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title