Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGFBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FGFBP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179846
View Documents
Novus Biologicals
NBP179846
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

FGFBP2 Polyclonal specifically detects FGFBP2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FGFBP2
Polyclonal
Rabbit
Angiogenesis
PBS and 2% Sucrose with 0.09% Sodium Azide
37 kDa killer-specific secretory protein, FGF-binding protein 2, FGF-BP2, FGFBP-2, fibroblast growth factor binding protein 2, fibroblast growth factor-binding protein 2, HBp17-RP, HBP17RP, killer-specific secretory protein of 37 kDa, Ksp37, KSP37HBp17-related protein
FGFBP2
IgG
Affinity Purified
24 kDa
Western Blot
Unconjugated
RUO
Human
NP_114156
83888
Synthetic peptide directed towards the C terminal of human FGFBP2The immunogen for this antibody is FGFBP2. Peptide sequence LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit