Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGFR5/FGFRL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$377.03 - $727.54
Specifications
| Antigen | FGFR5/FGFRL1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FGFR5/FGFRL1 Polyclonal specifically detects FGFR5/FGFRL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FGFR5/FGFRL1 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 53834 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVAS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| FGF homologous factor receptor, FGF receptor-like protein 1, FGFR5, FGFR-5, FGFR-like protein, FHFR, Fibroblast growth factor receptor 5, fibroblast growth factor receptor-like 1 | |
| FGFRL1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title