FGGY carbohydrate kinase domain containing Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324712

Catalog No. NB301740

Description

FGGY carbohydrate kinase domain containing Polyclonal antibody specifically detects FGGY carbohydrate kinase domain containing in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: FGGY carbohydrate kinase domain containing
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: EC 2.7.1, EC 2.7.1.-, FGGY carbohydrate kinase domain containing, FGGY carbohydrate kinase domain-containing protein, FLJ10986
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein FGGY carbohydrate kinase domain containing using the following amino acid sequence: TGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAA
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 55277
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified