Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fibrinogen beta chain Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310547100UL
Description
Fibrinogen beta chain Polyclonal specifically detects Fibrinogen beta chain in Human samples. It is validated for Western Blot.Specifications
Fibrinogen beta chain | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Beta-Fibrinogen, epididymis secretory sperm binding protein Li 78p, fibrinogen beta chain, fibrinogen, B beta polypeptide, HEL-S-78p, MGC104327, MGC120405 | |
The immunogen is a synthetic peptide directed towards the middle region of human Fibrinogen beta chain (NP_001171670.1). Peptide sequence GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK | |
100 μg | |
Cell Cycle and Replication | |
2244 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction