Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fibulin-3/EFEMP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Fibulin-3/EFEMP1 |
|---|---|
| Dilution | Western Blot 1:100 - 1:250, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Fibulin-3/EFEMP1 Polyclonal specifically detects Fibulin-3/EFEMP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Fibulin-3/EFEMP1 | |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 2202 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:100 - 1:250, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| DHRD, EGF containing fibulin-like extracellular matrix protein 1, EGF-containing fibulin-like extracellular matrix protein 1, Extracellular protein S1-5, FBLN3DRAD, FBNLFLJ35535, FIBL-3, fibrillin-like, Fibrillin-like protein, Fibulin-3, MGC111353, MLVT, MTLV, S1-5 | |
| EFEMP1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title