FIP1/RCP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418878	Novus Biologicals NBP18359825UL	25 μL
NBP183598	Novus Biologicals NBP183598	0.1 mL

Description

FIP1/RCP Polyclonal specifically detects FIP1/RCP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FIP1/RCP
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp686E2214, EC 3.2.1.28, EC 6.1.1.7, FLJ22524, FLJ22622, MGC78448, NOEL1A, RAB11 coupling protein, RAB11 family interacting protein 1 (class I), rab11 family-interacting protein 1, Rab11-FIP1, Rab-coupling protein, Rab-interacting recycling protein, RCPRab effector protein
• Gene Symbols: RAB11FIP1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q6WKZ4
• Gene ID (Entrez): 80223
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSEQLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only