Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FJX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15947020UL
Description
FJX1 Polyclonal specifically detects FJX1 in Human samples. It is validated for Western Blot.Specifications
FJX1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q86VR8 | |
FJX1 | |
Synthetic peptides corresponding to FJX1(four jointed box 1 (Drosophila)) The peptide sequence was selected from the N terminal of FJX1. Peptide sequence MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ22416, FLJ25593, four jointed box 1 (Drosophila), four-jointed box protein 1, Four-jointed protein homolog, putative secreted ligand homologous to fjx1 | |
Rabbit | |
Affinity Purified | |
RUO | |
24147 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction