FKBP51/FKBP5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436699	Novus Biologicals NBP23394425UL	25 μL
NBP233944	Novus Biologicals NBP233944	0.1 mL

Description

FKBP51/FKBP5 Polyclonal specifically detects FKBP51/FKBP5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FKBP51/FKBP5
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q13451
• Gene ID (Entrez): 2289
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 51 kDa FKBP, 54 kDa progesterone receptor-associated immunophilin, AIG6,51 kDa FK506-binding protein, Androgen-regulated protein 6, FF1 antigen, FK506 binding protein 5, FK506-binding protein 5, FKBP-5, FKBP-51, FKBP51PPIase FKBP5, FKBP54EC 5.2.1.8, HSP90-binding immunophilin, MGC111006, p54, P54,51 kDa FK506-binding protein 5, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP5, PPIase, Ptg-10, rotamase, T-cell FK506-binding protein
• Gene Symbols: FKBP5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only