Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Flavin containing monooxygenase 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Flavin containing monooxygenase 4
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP169026 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP169026	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

Flavin containing monooxygenase 4 Polyclonal specifically detects Flavin containing monooxygenase 4 in Rat samples. It is validated for Western Blot.

Specifications

Antigen	Flavin containing monooxygenase 4
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q8K4B7
Gene ID (Entrez)	2329
Immunogen	Synthetic peptides corresponding to Fmo4 (flavin containing monooxygenase 4) The peptide sequence was selected from the middle region of Fmo4. Peptide sequence PGIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDVAVELSGIAAQV.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	dimethylaniline monooxygenase [N-oxide-forming] 4, Dimethylaniline oxidase 4, EC 1.14.13.8, flavin containing monooxygenase 4, FMO 4, FMO2, Hepatic flavin-containing monooxygenase 4
Gene Symbols	FMO4
Isotype	IgG
Molecular Weight of Antigen	64 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Flavin containing monooxygenase 4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents