Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FLJ10769 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FLJ10769
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP162516
View Documents
Novus Biologicals
NBP162516
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

FLJ10769 Polyclonal specifically detects FLJ10769 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FLJ10769
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
55739
Synthetic peptides corresponding to CARKD (carbohydrate kinase domain containing) The peptide sequence was selected from the middle region of CARKD. Peptide sequence RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
carbohydrate kinase domain containing, carbohydrate kinase domain-containing protein, FLJ10769, FLJ34548, FLJ52550, LP3298
CARKD
IgG
Affinity Purified
41 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit