Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FLJ10769 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FLJ10769 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP162516
|
Novus Biologicals
NBP162516 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FLJ10769 Polyclonal specifically detects FLJ10769 in Human samples. It is validated for Western Blot.Specifications
| FLJ10769 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 55739 | |
| Synthetic peptides corresponding to CARKD (carbohydrate kinase domain containing) The peptide sequence was selected from the middle region of CARKD. Peptide sequence RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| carbohydrate kinase domain containing, carbohydrate kinase domain-containing protein, FLJ10769, FLJ34548, FLJ52550, LP3298 | |
| CARKD | |
| IgG | |
| Affinity Purified | |
| 41 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title