Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FLRT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $727.54
Specifications
| Antigen | FLRT3 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FLRT3 Polyclonal specifically detects FLRT3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FLRT3 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| fibronectin leucine rich transmembrane protein 3, Fibronectin-like domain-containing leucine-rich transmembrane protein 3, HH21, KIAA1469, leucine-rich repeat transmembrane protein FLRT3 | |
| FLRT3 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9NZU0 | |
| 23767 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title