Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FNBP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | FNBP3 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
FNBP3 Polyclonal specifically detects FNBP3 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FNBP3 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Fas ligand-associated factor 1, Fas-ligand associated factor 1, FBP-11, FBP11Formin-binding protein 11, FLAF1Renal carcinoma antigen NY-REN-6, FLJ20585, FNBP3Huntingtin-interacting protein A, formin binding protein 3, Formin-binding protein 3Huntingtin-interacting protein 10, HIP10HIP-10, HYPAHuntingtin yeast partner A, NY-REN-6, NY-REN-6 antigen, pre-mRNA-processing factor 40 homolog A, Prp40, PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae), PRP40 pre-mRNA processing factor 40 homolog A (yeast) | |
| PRPF40A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O75400 | |
| 55660 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title